PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen05g025200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family SAP
Protein Properties Length: 702aa    MW: 77384.2 Da    PI: 6.5946
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen05g025200.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP55.49.6e-1815662778
               SAP 27 gesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfq 78
                      ge  ++s++ +r  n+vwpePf+e la  vaidas+slGrlaaa+ala ++q
  Sopen05g025200.1 15 GEGPSSSRRGRRVGNDVWPEPFVEDLALLVAIDASHSLGRLAAAQALALIYQ 66
                      22233444456799************************************98 PP

2SAP477.68.1e-146113411139439
               SAP 139 padvdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaa 231
                       + +++++n++d+l Cr+lalsd++laaGf++G+v+lf l  rlh+st++p+hrdrlGrfsravsGi++sd +lvfa+ldGdihv vi    aa
  Sopen05g025200.1 113 NDNNNNNNNNDSLFCRRLALSDHHLAAGFSNGSVQLFFLPRRLHLSTYHPHHRDRLGRFSRAVSGIILSDVQLVFASLDGDIHVVVIGD--AA 203
                       233456677899***************************************************************************98..78 PP

               SAP 232 aarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrl 324
                       ++rra+lGdvvndGalvdf+Gs++WwvGlyaGvpGrafhiW+ eteelvfvGG ltdPea+mGWh+lte+te+vGr+rvt retavaCtsl+l
  Sopen05g025200.1 204 PPRRAHLGDVVNDGALVDFTGSDQWWVGLYAGVPGRAFHIWNRETEELVFVGGELTDPEALMGWHLLTEITEIVGRIRVTTRETAVACTSLQL 296
                       ********************************************************************************************* PP

               SAP 325 vvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyaggvlrvWeiekkeg 416
                       +v+dl+nqg+++r + +rrG+iv+s+da+ne++v+vd+rG+a+vrr++nlee +rf+vrg  qrgv+gC+nggy+ ++ g v+rvW+ie+ + 
  Sopen05g025200.1 297 MVIDLQNQGIIIRAQPSRRGIIVASFDAYNETLVAVDTRGMANVRRADNLEERSRFTVRGaNQRGVVGCINGGYGFMWLGNVVRVWDIENGN- 388
                       ************************************************************99***************************976. PP

               SAP 417 ylyslrervgevnalvaddrhva 439
                       ylys+ er+g+vna++ad+r   
  Sopen05g025200.1 389 YLYSFGERIGDVNAIIADERNTQ 411
                       *******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF509782.2E-7106336IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.101.5E-4295415IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509782.2E-7378404IPR017986WD40-repeat-containing domain
SuperFamilySSF566724.89E-7511647No hitNo description
PfamPF077272.7E-50511639IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
CDDcd092721.00E-20645696No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MSSSQSPPSS LGGGGEGPSS SRRGRRVGND VWPEPFVEDL ALLVAIDASH SLGRLAAAQA  60
LALIYQGKRL TGLFNMASSV TLRYALAKPN KAYAYNTLHF VPQNNVEGDD DDNDNNNNNN  120
NNDSLFCRRL ALSDHHLAAG FSNGSVQLFF LPRRLHLSTY HPHHRDRLGR FSRAVSGIIL  180
SDVQLVFASL DGDIHVVVIG DAAPPRRAHL GDVVNDGALV DFTGSDQWWV GLYAGVPGRA  240
FHIWNRETEE LVFVGGELTD PEALMGWHLL TEITEIVGRI RVTTRETAVA CTSLQLMVID  300
LQNQGIIIRA QPSRRGIIVA SFDAYNETLV AVDTRGMANV RRADNLEERS RFTVRGANQR  360
GVVGCINGGY GFMWLGNVVR VWDIENGNYL YSFGERIGDV NAIIADERNT QAYNFNPIYN  420
YKRVAGNVHG TPIDSVLNER GDQMKKDADD NVNNVGAIAD SPDVGNGSVN FAGPFNEEAS  480
GDYEPLIYEE AAIEPSWQAA MTQEFEALHA NHTWILSPLP VGKRAIGCKW VYKVKHKADG  540
SIERFKAQLV VKDYTQQAEI DYVETFSPVL KMTIVRSLIA IAVKRGWDIS QLDVNNAFLH  600
GDLHEKVYME APPGLMVDTP GLVCKLNKSL YGLKQASRHH GCTVRAFCDS EWAVCLDSRI  660
SASGYIVLLG NTPISWKSKK QETTSLSSSQ AEYRALRKVV VK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075540.10.0PREDICTED: transcriptional regulator STERILE APETALA-like
SwissprotQ9FKH11e-121SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLK4C0A30.0K4C0A3_SOLLC; Uncharacterized protein
STRINGSolyc05g041220.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40992345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-118SAP family protein